HORDB

General Information

ID: hor006617
Uniprot ID: P05060
Protein name: CCB peptide
Gene name: CHGB
Organism: Homo sapiens (Human)
Family: Chromogranin/secretogranin protein family
Source: Human
Expression: Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver.
Disease: Diseases associated with CHGB include Pheochromocytoma and Neuroendocrine Tumor.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005515 protein binding
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005788 endoplasmic reticulum lumen; GO:0030141 secretory granule

Sequence Information

Sequence: SAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQR
Length: 60
Propeptide: MQPTLLLSLLGAVGLAAVNSMPVDNRNHNEGMVTRCIIEVLSNALSKSSAPPITPECRQVLKTSRKDVKDKETTENENTKFEVRLLRDPADASEAHESSSRGEAGAPGEEDIQGPTKADTEKWAEGGGHSRERADEPQWSLYPSDSQVSEEVKTRHSEKSQREDEEEEEGENYQKGERGEDSSEEKHLEEPGETQNAFLNERKQASAIKKEELVARSETHAAGHSQEKTHSREKSSQESGEETGSQENHPQESKGQPRSQEESEEGEEDATSEVDKRRTRPRHHHGRSRPDRSSQGGSLPSEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG
Signal peptide: MQPTLLLSLLGAVGLAAVNS
Modification: T1 Phosphoserine;T8 Sulfotyrosine;T10 Phosphoserine;T15 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P05060-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006617_AF2.pdb

hor006617_ESM.pdb

Physical Information

Mass:	802706	Formula:	C299H465N79O111S
Absent amino acids:	CGW	Common amino acids:	E
pI:	3.96	Basic residues:	8
Polar residues:	10	Hydrophobic residues:	17
Hydrophobicity:	-120.83	Boman Index:	-19343
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	58.67
Instability Index:	5237	Extinction Coefficient cystines:	1490
Absorbance 280nm:	25.25

Literature

PubMed ID: 3608978
Title: The primary structure of human secretogranin I (chromogranin B): comparison with chromogranin A reveals homologous terminal domains and a large intervening variable region.
PubMed ID: 14702039
Title: Complete sequencing and characterization of 21,243 full-length human cDNAs.
PubMed ID: 11780052
Title: The DNA sequence and comparative analysis of human chromosome 20.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 1882087
Title: Chromogranin B: isolation from pheochromocytoma, N-terminal sequence, tissue distribution and secretory vesicle processing.
PubMed ID: 7784254
Title: Identification of a new chromogranin B fragment (314-365) in endocrine tumors.
PubMed ID: 3970711
Title: GAWK, a novel human pituitary polypeptide: isolation, immunocytochemical localization and complete amino acid sequence.
PubMed ID: 3678488
Title: Chromogranin B (secretogranin I), a putative precursor of two novel pituitary peptides through processing at paired basic residues.
PubMed ID: 14997482
Title: Identification and characterization of phosphorylated proteins in the human pituitary.
PubMed ID: 16807684
Title: Phosphoproteomic analysis of the human pituitary.
PubMed ID: 23234360
Title: LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
PubMed ID: 24275569
Title: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
PubMed ID: 26091039
Title: A Single Kinase Generates the Majority of the Secreted Phosphoproteome.